Recombinant Human Angiostatin K1-3 
Datasheet
COA
MSDS
SHIP
Recombinant :
Recombinant Human Angiostatin K1-3 Source :
Escherichia coli. Molecular Weight :
Approximately 30.0 KDa, a single non-glycosylated polypeptide chain containing 259 amino acids. Purity :
>95% by SDS-PAGE and HPLC analyses. Biological Activity :
Fully biologically active when compared to standard. The activity is assayed on anti-proliferation and anti-migration of endothelial cells in vitro and anti-angiogenesis in vivo. The specific activity of anti-migration of endothelial cells in vitro is 0.55×105Units/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2μm filtered concentrated solution in 20mM NaAc, pH5.5, 4% mannitol. AA Sequence :
VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP Endotoxin :
Less than 1EU/μg of rHuAngiostatin as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Angiostatin K1-3 is a ~30 kDa fragment of plasminogen that has been shown to act as a potent inhibitor of angiogenesis and tumor growth in vitro and in vivo. Recombinant angiostatin is expressed in E. coli.
Recombinant Human Angiostatin K1-3 Source :
Escherichia coli. Molecular Weight :
Approximately 30.0 KDa, a single non-glycosylated polypeptide chain containing 259 amino acids. Purity :
>95% by SDS-PAGE and HPLC analyses. Biological Activity :
Fully biologically active when compared to standard. The activity is assayed on anti-proliferation and anti-migration of endothelial cells in vitro and anti-angiogenesis in vivo. The specific activity of anti-migration of endothelial cells in vitro is 0.55×105Units/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2μm filtered concentrated solution in 20mM NaAc, pH5.5, 4% mannitol. AA Sequence :
VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP Endotoxin :
Less than 1EU/μg of rHuAngiostatin as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Angiostatin K1-3 is a ~30 kDa fragment of plasminogen that has been shown to act as a potent inhibitor of angiogenesis and tumor growth in vitro and in vivo. Recombinant angiostatin is expressed in E. coli.
Blocking peptide available as PR1001P