Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Human Keratinocye Growth Factor-1 (rHuKGF-1) PR1079
RecombinantRecombinant Human Keratinocye Growth Factor-1 (rHuKGF-1)
Catalog No.PR1079
SourceEscherichia coli.
Molecular WeightApproximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids.
Purity>96% by SDS-PAGE and HPLC analyses.
Biological ActivityThe biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 <10ng/ml,corresponding to a specific activity of ≥ 1 x 105 units/mg.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl.
EndotoxinLess than 1EU/mg of rHuKGF-1 as determined by LAL method.
Browse similar products>>
Size Price
2µg $158
10µg $298
1.0mg $enquire
Add to cart My orders
Recombinant :
Recombinant Human Keratinocye Growth Factor-1 (rHuKGF-1)
Source :
Escherichia coli.
Molecular Weight :
Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids.
Purity :
>96% by SDS-PAGE and HPLC analyses.
Biological Activity :
The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 <10ng/ml,corresponding to a specific activity of ≥ 1 x 105 units/mg.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl.
AA Sequence :
MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLP MAIT
Endotoxin :
Less than 1EU/mg of rHuKGF-1 as determined by LAL method.
Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage :
This lyophilized preparation is stable for several weeks at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Description :
Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing.
Blocking peptide available as PR1079P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER