Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Human MCP-2 (rHu MCP-2/CCL8) PR1087
RecombinantRecombinant Human MCP-2 (rHu MCP-2/CCL8)
Catalog No.PR1087
SourceEscherichia coli.
Molecular Weight8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.
Purity>96% by SDS-PAGE and HPLC analyses.
Biological ActivityFully biologically active when compared to standard. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 for this effect is typically 0.03-0.1μg/mL, corresponding to a Specific Activity of >1 x 104 IU/mg.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
EndotoxinLess than 1EU/mg of rHuMCP-2/CCL8 as determined by LAL method.
Browse similar products>>
Size Price
2µg $158
10µg $298
1.0mg $enquire
Add to cart My orders
Recombinant :
Recombinant Human MCP-2 (rHu MCP-2/CCL8)
Source :
Escherichia coli.
Molecular Weight :
8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.
Purity :
>96% by SDS-PAGE and HPLC analyses.
Biological Activity :
Fully biologically active when compared to standard. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50 for this effect is typically 0.03-0.1μg/mL, corresponding to a Specific Activity of >1 x 104 IU/mg.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
AA Sequence :
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Endotoxin :
Less than 1EU/mg of rHuMCP-2/CCL8 as determined by LAL method.
Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Description :
MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the CC family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1.MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other CC chemokines, all three MCP proteins are monocyte chemoattractants. In addition,the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes. All three cytokines have also been shown to attract eosinophils and induce histamine secretion from basophils.
Blocking peptide available as PR1087P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER