Recombinant :
Recombinant Human Oncostatin-M(209a.a.) (rHuOSM 209a.a.) Source :
Escherichia coli. Molecular Weight :
Approximately 23.9 kDa, a single non-glycosylated polypeptide chain containing 209 amino acids. Purity :
>97% by SDS-PAGE and HPLC analyses. Biological Activity :
Fully biologically active when compared to the standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is < 2 ng/ml, corresponding to a specific activity of > 5×105units/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. AA Sequence :
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR Endotoxin :
Less than 1EU/μg of rHuOSM(209a.a.) as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposi's sarcoma cells, OSH can exert both stimulatory and inhibitory effects on cell proliferation. It stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposi's sarcoma cells, but, inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release (e.g. IL-6, GM-CSF and G-CSF) from endothelial cells, and enhances the expression of low-density lipoprotein receptor in hepatoma cells. OSM share several structural and functional characteristics with LIF, IL-6, and CNTF. Human OSM is active on murine cells.
Recombinant Human Oncostatin-M(209a.a.) (rHuOSM 209a.a.) Source :
Escherichia coli. Molecular Weight :
Approximately 23.9 kDa, a single non-glycosylated polypeptide chain containing 209 amino acids. Purity :
>97% by SDS-PAGE and HPLC analyses. Biological Activity :
Fully biologically active when compared to the standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is < 2 ng/ml, corresponding to a specific activity of > 5×105units/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. AA Sequence :
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR Endotoxin :
Less than 1EU/μg of rHuOSM(209a.a.) as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposi's sarcoma cells, OSH can exert both stimulatory and inhibitory effects on cell proliferation. It stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposi's sarcoma cells, but, inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release (e.g. IL-6, GM-CSF and G-CSF) from endothelial cells, and enhances the expression of low-density lipoprotein receptor in hepatoma cells. OSM share several structural and functional characteristics with LIF, IL-6, and CNTF. Human OSM is active on murine cells.
Blocking peptide available as PR1105P