Recombinant Human Brain Natriuretic
Peptide (rHuBNP )
Datasheet
COA
MSDS
SHIP
Recombinant :
Recombinant Human Brain Natriuretic Peptide (rHuBNP ) Source :
Escherichia coli. Molecular Weight :
3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids. Purity :
>97% by SDS-PAGE and HPLC analyses. Biological Activity :
Data Not Available. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4. AA Sequence :
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Endotoxin :
Less than 1EU/g of rHuCNTF as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Recombinant Human Brain Natriuretic Peptide (rHuBNP ) Source :
Escherichia coli. Molecular Weight :
3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids. Purity :
>97% by SDS-PAGE and HPLC analyses. Biological Activity :
Data Not Available. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4. AA Sequence :
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Endotoxin :
Less than 1EU/g of rHuCNTF as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8C, but should be kept at -20C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20C to -70C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Blocking peptide available as PR1011P