Recombinant Mouse Leukemia inhibitory
factor(rMuLIF)
Datasheet
COA
MSDS
SHIP
Recombinant :
Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Source :
Escherichia coli. Molecular Weight :
Approximately20 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids. Purity :
>98% by SDS-PAGE and HPLC analyses. Biological Activity :
The activity of mouse LIF is determined by the ability to induce differentiation of murine M1myeloid leukemic cells. The minimum detectable concentration of mouse LIF in this assay is0.5 ng/mL. The specific activity is >1 x 108 units/mg, where 50 units is defined as the amountof mouse LIF required to induce differentiation in 50% of the M1 colonies in 1 mL agarcultures. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20. AA Sequence :
MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF Endotoxin :
Less than 1EU/mg of rmLIF as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Leukemia Inhibitory Factor (LIF) is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency,bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Mouse LIF is a 20 kDa protein containing 181 amino acid residues.
Recombinant Mouse Leukemia inhibitory factor(rMuLIF) Source :
Escherichia coli. Molecular Weight :
Approximately20 kDa, a single non-glycosylated polypeptide chain containing 181 amino acids. Purity :
>98% by SDS-PAGE and HPLC analyses. Biological Activity :
The activity of mouse LIF is determined by the ability to induce differentiation of murine M1myeloid leukemic cells. The minimum detectable concentration of mouse LIF in this assay is0.5 ng/mL. The specific activity is >1 x 108 units/mg, where 50 units is defined as the amountof mouse LIF required to induce differentiation in 50% of the M1 colonies in 1 mL agarcultures. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, with 0.02% TWEEN 20. AA Sequence :
MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF Endotoxin :
Less than 1EU/mg of rmLIF as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Leukemia Inhibitory Factor (LIF) is a lymphoid factor which promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency,bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Mouse LIF is a 20 kDa protein containing 181 amino acid residues.
Blocking peptide available as PR2005P