Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24) PR1017
RecombinantRecombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24)
Catalog No.PR1017
SourceEscherichia coli.
Molecular Weight8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids.
Purity>97% by SDS-PAGE and HPLC analyses.
Biological ActivityFully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood eosinophils using a concentration range of 50.0 -100.0 ng/ml, corresponding to a Specific Activity of >1 x 104 IU/mg.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
EndotoxinLess than 1EU/mg of rHuEotaxin-2/CCL24 as determined by LAL method.
Browse similar products>>
Size Price
5µg $158
20µg $298
1.0mg $enquire
Add to cart My orders
Recombinant :
Recombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24)
Source :
Escherichia coli.
Molecular Weight :
8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids.
Purity :
>97% by SDS-PAGE and HPLC analyses.
Biological Activity :
Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood eosinophils using a concentration range of 50.0 -100.0 ng/ml, corresponding to a Specific Activity of >1 x 104 IU/mg.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
AA Sequence :
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA
Endotoxin :
Less than 1EU/mg of rHuEotaxin-2/CCL24 as determined by LAL method.
Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Description :
Eotaxin, also named MPIF-2 and Ckβ6, is a novel CC chemokine recently identified. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Additionally, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which also includes a C-terminal truncation, contains 78 amino acid residues (92 a.a. residues for the murine homolog, without C-terminal truncation).
Blocking peptide available as PR1017P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER