Recombinant Human Lymphotactin
(rHuLymphotactin/XCL1)
Datasheet
COA
MSDS
SHIP
Recombinant :
Recombinant Human Lymphotactin (rHuLymphotactin/XCL1) Source :
Escherichia coli Molecular Weight :
10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids. Purity :
>97% by SDS-PAGE and HPLC analyses. Biological Activity :
Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of ＞1 x 104 IU/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl. AA Sequence :
GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Endotoxin :
Less than 1EU/mg of rHuCXCL13 as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.
Recombinant Human Lymphotactin (rHuLymphotactin/XCL1) Source :
Escherichia coli Molecular Weight :
10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids. Purity :
>97% by SDS-PAGE and HPLC analyses. Biological Activity :
Fully biologically active when compared to standard. Determined by its ability to chemoattract human T cells using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of ＞1 x 104 IU/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl. AA Sequence :
GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG Endotoxin :
Less than 1EU/mg of rHuCXCL13 as determined by LAL method. Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China Description :
Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.
Blocking peptide available as PR1082P