Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA(CXCL1) ) PR1036
RecombinantRecombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA(CXCL1) )
Catalog No.PR1036
SourceEscherichia coli.
Molecular Weight7.8 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Purity>97% by SDS-PAGE and HPLC analyses.
Biological ActivityFully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 10.0-50.0 ng/ml, corresponding to a Specific Activity of >2 x 104 IU/mg.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
EndotoxinLess than 1EU/mg of rHuGRO-alpha/CXCL1 as determined by LAL method.
Browse similar products>>
Size Price
5µg $158
25µg $298
1.0mg $enquire
Add to cart My orders
Recombinant :
Recombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA(CXCL1) )
Source :
Escherichia coli.
Molecular Weight :
7.8 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Purity :
>97% by SDS-PAGE and HPLC analyses.
Biological Activity :
Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 10.0-50.0 ng/ml, corresponding to a Specific Activity of >2 x 104 IU/mg.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
AA Sequence :
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Endotoxin :
Less than 1EU/mg of rHuGRO-alpha/CXCL1 as determined by LAL method.
Reconstitution :
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage :
This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China
Description :
The three GRO cDNAs encode 107 amino acid precursor proteins from which the N-terminal 34 amino acid residues are cleaved to generate the mature GROs. There are no potential N-linked glycosylation sites in the amino acid sequences. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively. Similar to other alpha chemokines, the three GRO proteins are potent neutrophil attractants and activators. In addition, these chemokines are also active toward basophils. All three GROs can bind with high affinity to the IL-8 receptor type B.
Blocking peptide available as PR1036P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER