Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant TRAIL/Apo2L, Human  BK0176-1mg
RecombinantRecombinant TRAIL/Apo2L, Human 
Catalog No.BK0176-1mg
SourceEscherichia coli.
Molecular Weight19.6 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50 < 40 ng/mL, measured by the cell growth inhibitory assay using RPMI-8226 cells, corresponding to a specific activity of > 2.5 × 10ˆ4 units/mg.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
1mg  $1760
$
Add to cart My orders
Recombinant :
Recombinant TRAIL/Apo2L, Human 
Source :
Escherichia coli.
Molecular Weight :
19.6 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50 < 40 ng/mL, measured by the cell growth inhibitory assay using RPMI-8226 cells, corresponding to a specific activity of > 2.5 × 10ˆ4 units/mg.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
MVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGE LVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSK DAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant human TRAIL/Apo2L (rhTRAIL) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhTRAIL remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
TRAIL/Apo2L, also known as Tumor Necrosis Factor Super-Family 10 (TNFSF10), is a pleiotropic cytokine thatbelongs to the TNF superfamily. The full length TRAIL expressed in vivo is a Type II transmembrane protein, although the soluble form also exists and functions. TRAIL has four major receptors: two death receptors DR4 and DR5, two decoy receptors DcR1 and DcR2. TRAIL binds to the death receptors, recruits the FAS-associated death domain, activates caspases 8 and 10, and eventually leads to apoptosis. Because of its antitumor potential, TRAIL is actively studied as a therapeutic agent. On the other hand, abnormal expression of TRAIL in small arteries can induce the proliferation of smooth muscle cells, resulting in increasing vascular remodeling and pulmonary arterial hypertension. Recombinant human TRAIL/Apo2L (rhTRAIL) produced in E.coli is a single non-glycosylated polypeptide chain containing 169 amino acids. A fully biologically active molecule, rhTRAIL has a molecular mass of 19.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques at GenScript.
Blocking peptide available as BK0176-1mgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER