Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Adiponectin, Human(CHO-expressed)  BK0182-10μg
RecombinantRecombinant Adiponectin, Human(CHO-expressed) 
Catalog No.BK0182-10μg
SourceCHO
Molecular Weight25~28 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50 < 2ng/ml, measured in a cell growth inhibition assay using M1 cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
10μg  $156
$
Add to cart My orders
Recombinant :
Recombinant Adiponectin, Human(CHO-expressed) 
Source :
CHO
Molecular Weight :
25~28 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50 < 2ng/ml, measured in a cell growth inhibition assay using M1 cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQ GRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKK DKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human Adiponectin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adiponectinshould be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Adiponectin is an important adipokine involved in the control of fat metabolism and insulin sensitivity. It is synthesized exclusively by adipocytes and secreted into plasma. It antagonizes THF-alpha by negatively regulating its expression. It also inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin can form low molecular weight complexes (LMW), middle molecular weight complexes (MMW) and higher molecular weight complexes (HMW). These bind to various growth factors, such as HBEGF, PDGFB and FGF2, and play a role in cell growth, angiogenesis and tissue remodeling.
Blocking peptide available as BK0182-10μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER