Recombinant :
Recombinant Epigen, Human(CHO-expressed) Source :
CHO Molecular Weight :
15~20 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 1 μg/ml, measured in a proliferation assay using 3T3 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY A Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human Epigen remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.
Recombinant Epigen, Human(CHO-expressed) Source :
CHO Molecular Weight :
15~20 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 1 μg/ml, measured in a proliferation assay using 3T3 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
AVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSY A Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human Epigen remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Epigen should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Epigen is an EGF-related polypeptide growth factor that signals through the ErbB receptor-1. It is produced in several tissues, including the testis, liver, heart and in certain tumor cells. Epigen is mitogenic for fibroblasts and epithelial cells. Human Epigen is initially synthesized as a glycosylated precursor protein, which is processed by proteolytic cleavage to produce a mature soluble sequence.
Blocking peptide available as BK0197-10μgP