Recombinant Flt-3L, Human 
Datasheet
COA
MSDS
SHIP
Recombinant :
Recombinant Flt-3L, Human Source :
CHO Molecular Weight :
Multiple bands between 18~22 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50< 1 ng/ml, measured in a cell proliferation assay of human AML5 cells, corresponding to a specific activity of > 1 x 10ˆ6 units/mg Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA Endotoxin :
<0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant human Fms-related tyrosine kinase 3 ligand (Flt-3 Ligand) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFlt-3L should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Fms-related tyrosine kinase 3 ligand (Flt3L) is growth fator stimulates the proliferation and differentiation of hematopoietic multipotent progenitors and promotes proliferation of NK cells and dendritic cell subgroups by combination with other growth factors. Flt3L is produced by T cells and stromal fibroblasts, and targeted various cells including hematopoietic stem cells, B cells, T cells, dendritic cells, and NK cells [1][2]. Flt3L binds to it cognate tyrosine kinase receptor Flt3 and activates JAK/STAT signaling pathway[3].Flt3L is a hematopoietic four helical bundle cytokine with structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1) demonstrated four conserved cysteines and two glycosylation sites. Flt3L naturally as a non-disulfide-linked homodimer with multiple isoforms. The extracellular portion is approximately 160 amino acid residues in length and the cytoplasmic segment is approximately 20-30 amino acid residues in length[4].
Recombinant Flt-3L, Human Source :
CHO Molecular Weight :
Multiple bands between 18~22 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50< 1 ng/ml, measured in a cell proliferation assay of human AML5 cells, corresponding to a specific activity of > 1 x 10ˆ6 units/mg Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA Endotoxin :
<0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant human Fms-related tyrosine kinase 3 ligand (Flt-3 Ligand) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFlt-3L should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Fms-related tyrosine kinase 3 ligand (Flt3L) is growth fator stimulates the proliferation and differentiation of hematopoietic multipotent progenitors and promotes proliferation of NK cells and dendritic cell subgroups by combination with other growth factors. Flt3L is produced by T cells and stromal fibroblasts, and targeted various cells including hematopoietic stem cells, B cells, T cells, dendritic cells, and NK cells [1][2]. Flt3L binds to it cognate tyrosine kinase receptor Flt3 and activates JAK/STAT signaling pathway[3].Flt3L is a hematopoietic four helical bundle cytokine with structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1) demonstrated four conserved cysteines and two glycosylation sites. Flt3L naturally as a non-disulfide-linked homodimer with multiple isoforms. The extracellular portion is approximately 160 amino acid residues in length and the cytoplasmic segment is approximately 20-30 amino acid residues in length[4].
Blocking peptide available as BK0203-1mgP