Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant GCP-2/CXCL6, Human  BK0205-5μg
RecombinantRecombinant GCP-2/CXCL6, Human 
Catalog No.BK0205-5μg
SourceCHO
Molecular Weight9 kDa, observed by reducing SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Biological ActivityThe EC50 value of human GCP-2/CXCL6 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 0.8 μg/ml.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
5μg  $132
$
Add to cart My orders
Recombinant :
Recombinant GCP-2/CXCL6, Human 
Source :
CHO
Molecular Weight :
9 kDa, observed by reducing SDS-PAGE.
Purity :
> 98% as analyzed by SDS-PAGE.
Biological Activity :
The EC50 value of human GCP-2/CXCL6 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 0.8 μg/ml.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant human GCP-2/CXCL6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human GCP-2/CXCL6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human CXC chemokines, GCP­2 is most closely related to ENA­78 (78% amino acid (aa) sequence identity in the mature peptide region and 86% identity in the signal sequence). The structure and sequence of the genes for human GCP­2 and ENA­78 also exhibit close similarity suggesting the two genes may have originated from a gene duplication. GCP­2 can signal through the CXCR1 and CXCR2 receptors.Recombinant human GCP-2/CXCL6 produced in CHO cells is a polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhGCP-2/CXCL6 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0205-5μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER