Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant GDNF, Human  BK0208-10μg
RecombinantRecombinant GDNF, Human 
Catalog No.BK0208-10μg
SourceCHO
Molecular Weight30.4 kDa (homo-dimer), observed by non-reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50< 1 µg/ml, measured in a cell proliferation assay using rat C6 cells, corresponding to a specific activity of >1 x 10ˆ3 units/mg
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin<0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
10μg   $156
$
Add to cart My orders
Recombinant :
Recombinant GDNF, Human 
Source :
CHO
Molecular Weight :
30.4 kDa (homo-dimer), observed by non-reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50< 1 µg/ml, measured in a cell proliferation assay using rat C6 cells, corresponding to a specific activity of >1 x 10ˆ3 units/mg
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDL SFLDDNLVYHILRKHSAKRCGCI
Endotoxin :
<0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant human Glial cell line-derived neurotrophic factor (G-DNF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhG-DNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Glial cell line-derived neurotrophic factor (G-DNF) is a neurotrophic factors belong to TGF-beta super family necessary for neuron survival and phenotypic maintenance in central and peripheral nervous systems [1]. G-DNF has the potent to support the differentiation and survival of many neuron subpopulations, prominent for dopaminergic neurons [2] and motor neurons [3], as well as Purkinje cells and sympathetic neurons. Sertoli cells, type 1 astrocytes, Schwann cells, neurons, pinealocytes and skeletal muscle cells are known to express GDNF in human [4]. GDNF has shown to interact with GFRA2 and GDNF family receptor alpha 1 [5,6]. Mutations in this gene may be associated with Hirschsprung's disease, Parkinson's disease and amyotrophic lateral sclerosis (ALS) [7].The recombinant human G-DNF expressed in CHO cells is disulfide-linked homo-dimer, with an apparent molecular weight of ~30.4 kDa.
Blocking peptide available as BK0208-10μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER