Recombinant :
Recombinant GDNF, Mouse Source :
CHO Molecular Weight :
17-22 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50 <8μg /ml, measured in a bioassay using C6 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYD KILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant murine GDNF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine GDNF should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Glial-Derived Neurotrophic Factor, also known as GDNF and ATF-1, is a neurotrophic factor belonging to the TGF-beta family. It is expressed in both central nervous system (CNS) and non-CNS tissues. GDNF signals through a receptor system composed of a RET and one of the four GFR alpha receptors. It promotes the survival and differentiation of dopaminergic neurons, and increases their high-affinity dopamine uptake. In a mouse Parkinson’s Disease model, GDNF has been shown to improve bradykinesia, rigidity, and postural instability. GDNF has also been shown to regulate kidney development, spermatogenesis and affect alcohol consumption.
Recombinant GDNF, Mouse Source :
CHO Molecular Weight :
17-22 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50 <8μg /ml, measured in a bioassay using C6 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYD KILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant murine GDNF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine GDNF should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Glial-Derived Neurotrophic Factor, also known as GDNF and ATF-1, is a neurotrophic factor belonging to the TGF-beta family. It is expressed in both central nervous system (CNS) and non-CNS tissues. GDNF signals through a receptor system composed of a RET and one of the four GFR alpha receptors. It promotes the survival and differentiation of dopaminergic neurons, and increases their high-affinity dopamine uptake. In a mouse Parkinson’s Disease model, GDNF has been shown to improve bradykinesia, rigidity, and postural instability. GDNF has also been shown to regulate kidney development, spermatogenesis and affect alcohol consumption.
Blocking peptide available as BK0209-25μgP