Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant GM-CSF, Mouse  BK0212-1mg
RecombinantRecombinant GM-CSF, Mouse 
Catalog No.BK0212-1mg
SourceCHO
Molecular Weight15~19 kDa, observed by non-reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50 < 0.05 ng/ml, measured in a cell proliferation assay using mouse FDC-P1 cells, corresponding to a specific activity of >2 x 10ˆ7 units/mg.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin<0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
1mg  $3360
$
Add to cart My orders
Recombinant :
Recombinant GM-CSF, Mouse 
Source :
CHO
Molecular Weight :
15~19 kDa, observed by non-reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50 < 0.05 ng/ml, measured in a cell proliferation assay using mouse FDC-P1 cells, corresponding to a specific activity of >2 x 10ˆ7 units/mg.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
Endotoxin :
<0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant murine Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.
Blocking peptide available as BK0212-1mgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER