Recombinant GRO-α/KC/CXCL1, Mouse(CHO-expressed) 
Datasheet
COA
MSDS
SHIP
Recombinant :
Recombinant GRO-α/KC/CXCL1, Mouse(CHO-expressed) Source :
CHO Molecular Weight :
5-7 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
Active at 10 ng/ml, measured in a tube formation assay using HUVEC cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Mouse GRO remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse GRO should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemokine receptor CXCR1 and CXCR2, and functions to chemoattract and activate neutrophils and basophils. It is also a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. GRO has also been reported to play a role in spinal cord development, angiogenesis, wound healing and tumorigenesis.
Recombinant GRO-α/KC/CXCL1, Mouse(CHO-expressed) Source :
CHO Molecular Weight :
5-7 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
Active at 10 ng/ml, measured in a tube formation assay using HUVEC cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Mouse GRO remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse GRO should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemokine receptor CXCR1 and CXCR2, and functions to chemoattract and activate neutrophils and basophils. It is also a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. GRO has also been reported to play a role in spinal cord development, angiogenesis, wound healing and tumorigenesis.
Blocking peptide available as BK0216-1mgP