Recombinant :
Recombinant HB-EGF, Human Source :
CHO Molecular Weight :
12-14 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50 <0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin.
Recombinant HB-EGF, Human Source :
CHO Molecular Weight :
12-14 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50 <0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin.
Blocking peptide available as BK0218-5μgP