Recombinant :
Recombinant HCC‑4/CCL16, Human(CHO-expressed) Source :
CHO Molecular Weight :
12 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of human HCC‑4/CCL16 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant human HCC‑4/CCL16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human HCC‑4/CCL16 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Human HCC4, also named NCC4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1). It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES. Recombinant human HCC‑4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC‑4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Recombinant HCC‑4/CCL16, Human(CHO-expressed) Source :
CHO Molecular Weight :
12 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of human HCC‑4/CCL16 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR1 cells (human Ga15 and human CCR1 stably expressed in CHO-K1 cells) is less than 1.5 μg/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLST VKIITAKNGQPQLLNSQ Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant human HCC‑4/CCL16 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human HCC‑4/CCL16 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Human HCC4, also named NCC4and Chemokine (C-C motif) ligand 16 (CCL16) is a small cytokine belonging to the CC chemokine family that is known under several pseudonyms, including Liver-expressed chemokine (LEC) and Monotactin-1 (MTN-1). It can signal through the CCR8 and CCR1 receptors, and it is chemotactic towards monocytes and lymphocytes but not neutrophils. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly up-regulated in the presence of IL-10. HCC-4 induces a calcium flux in thp-1 cells that are desensitized prior to the expression of RANTES. Recombinant human HCC‑4/CCL16 produced in CHO cells is a single non-glycosylated polypeptide chain containing 97 amino acids. A fully biologically active molecule, rhHCC‑4/CCL16has a molecular mass of 12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0219-1mgP