Recombinant IL-13, His, Mouse(CHO-expressed) 
Datasheet
COA
MSDS
SHIP
Recombinant :
Recombinant IL-13, His, Mouse(CHO-expressed) Source :
CHO Molecular Weight :
14-30 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 20 ng /ml, measured in a cell proliferation assay using R&D TF-1 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTV SSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2). IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion.
Recombinant IL-13, His, Mouse(CHO-expressed) Source :
CHO Molecular Weight :
14-30 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 20 ng /ml, measured in a cell proliferation assay using R&D TF-1 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTV SSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2). IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion.
Blocking peptide available as BK0231-50μgP