Recombinant :
Recombinant IL-17A, His, Human Source :
CHO Molecular Weight :
14-22 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 0.3 ng/ml, measured in a bioassay using NHDF cells, corresponding to a specific activity of > 3.3×10ˆ6 units/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant humanInterleukin-17A (IL-17A), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Interleukin-17A (IL-17A), His should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-17A (IL-17A),also known as CTLA-8 and IL-17, is a proinflammatory cytokine belonging to the IL-17 family. It is secreted by Th17 cells, gamma/delta T cells, NK cells and neutrophils. IL-17A signals through IL-17 receptor A in a complex with receptor C or D to regulate NF-kappaB and MAP kinase activities. IL-17A plays important roles in the anti-microbial response and chronic inflammation. It stimulates the production of IL-6, IL-8 and G-CSF in epithelial and endothelial cells, and induces the expression of ICAM-1 in fibroblasts. Clinically, IL-17A has been associated with inflammatory diseases, such as rheumatoid arthritis, psoriasis and multiple sclerosis.Recombinant human Interleukin-17A (rhIL-17A) produced in CHO cells is a glycosylated homodimer chain containing 142 amino acids. A fully biologically active molecule, rhIL-17A has a molecular mass of around 14-22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Recombinant IL-17A, His, Human Source :
CHO Molecular Weight :
14-22 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 0.3 ng/ml, measured in a bioassay using NHDF cells, corresponding to a specific activity of > 3.3×10ˆ6 units/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant humanInterleukin-17A (IL-17A), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Interleukin-17A (IL-17A), His should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-17A (IL-17A),also known as CTLA-8 and IL-17, is a proinflammatory cytokine belonging to the IL-17 family. It is secreted by Th17 cells, gamma/delta T cells, NK cells and neutrophils. IL-17A signals through IL-17 receptor A in a complex with receptor C or D to regulate NF-kappaB and MAP kinase activities. IL-17A plays important roles in the anti-microbial response and chronic inflammation. It stimulates the production of IL-6, IL-8 and G-CSF in epithelial and endothelial cells, and induces the expression of ICAM-1 in fibroblasts. Clinically, IL-17A has been associated with inflammatory diseases, such as rheumatoid arthritis, psoriasis and multiple sclerosis.Recombinant human Interleukin-17A (rhIL-17A) produced in CHO cells is a glycosylated homodimer chain containing 142 amino acids. A fully biologically active molecule, rhIL-17A has a molecular mass of around 14-22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0234-1mgP

Recombinant IL-17A, His, Human
Datasheet
COA
MSDS
SHIP