Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant IL-17A, Mouse  BK0235-10μg
RecombinantRecombinant IL-17A, Mouse 
Catalog No.BK0235-10μg
SourceCHO
Molecular Weight15-22 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityMeasured by its ability to induce IL-1a, IL-4 and IL-6 production by primary mouse splenocytes.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
10μg  $132
$
Add to cart My orders
Recombinant :
Recombinant IL-17A, Mouse 
Source :
CHO
Molecular Weight :
15-22 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
Measured by its ability to induce IL-1a, IL-4 and IL-6 production by primary mouse splenocytes.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNA EGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Murine Interleukin-17A (IL-17A) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant murine IL-17A should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Interleukin-17A, (also known as CTLA-8) is a T cell-expressed pleiotropic cytokine that exhibits a high degree of homology to a protein encoded by the ORF13 gene of herpesvirus Saimiri. cDNA clones encoding IL-17 have been isolated from activated rat, mouse and human T cells. IL-17 represents a family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. Recombinant murine IL-17A is a 15-20kDa glycosylated cytokine of 133 amino acid polypeptide chain that plays an important role in antimicrobial and chronic inflammation. IL-17 exhibits multiple biological activities on a variety of cells including the induction of IL-6 and IL-8 production in fibroblasts, the enhancement of surface expression of ICAM-1 in fibroblasts, activation of NF-κB and costimulation of T cell proliferation.
Blocking peptide available as BK0235-10μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER