Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant IL-3, His, Rat  BK0242-50μg
RecombinantRecombinant IL-3, His, Rat 
Catalog No.BK0242-50μg
SourceCHO
Molecular Weight22-34 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
50μg  $493.8
$
Add to cart My orders
Recombinant :
Recombinant IL-3, His, Rat 
Source :
CHO
Molecular Weight :
22-34 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.
Blocking peptide available as BK0242-50μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER