Recombinant :
Recombinant IL-3, His, Rat Source :
CHO Molecular Weight :
22-34 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.
Recombinant IL-3, His, Rat Source :
CHO Molecular Weight :
22-34 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 8 ng/ml, measured in a cell proliferation assay using NF S-60 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKL KCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.
Blocking peptide available as BK0242-50μgP

Recombinant IL-3, His, Rat
Datasheet
COA
MSDS
SHIP