Recombinant :
Recombinant IL-4, His, Rat Source :
CHO Molecular Weight :
18-22 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.
Recombinant IL-4, His, Rat Source :
CHO Molecular Weight :
18-22 kDa, observed by reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE. Biological Activity :
ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.
Blocking peptide available as BK0244-25μgP

Recombinant IL-4, His, Rat
Datasheet
COA
MSDS
SHIP