Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant IL-5 Rα, Human  BK0248-1mg
RecombinantRecombinant IL-5 Rα, Human 
Catalog No.BK0248-1mg
SourceCHO
Molecular Weight53-56 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50 <0.2 ng/ml, measured in a cell proliferation assay using TF-1 cells in the presence of 1 ng/ml human IL-5.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
1mg  $8000
$
Add to cart My orders
Recombinant :
Recombinant IL-5 Rα, Human 
Source :
CHO
Molecular Weight :
53-56 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50 <0.2 ng/ml, measured in a cell proliferation assay using TF-1 cells in the presence of 1 ng/ml human IL-5.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRT ILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEK PVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDE
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human Interleukin-5 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-5 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Interleukin-5 Receptor Alpha (IL-5RA), also known as CD125, belongs to the Type 5 subfamily in the type I cytokine receptor family. It is composed of a ligand-specific alpha subunit and a signal-transducing beta subunit shared by the receptors for IL-3 and GM-CSF. IL-5RA is mainly expressed on eosinophils and basophils, and plays important roles in the immunobiology of these cell types. It is reported that when stimulated by IL-5, eosinophils down-regulate surface IL-5RA expression to attenuate their IL-5 responsiveness. Elevated IL-5 production may induce immune cell infiltration which leads to allergic inflammation. IL-5RA has also been reported to promote the differentiation of basophils and B cells.
Blocking peptide available as BK0248-1mgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER