Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant IL-8/CXCL8 (8-79aa), Human(CHO-expressed)  BK0258-1mg
RecombinantRecombinant IL-8/CXCL8 (8-79aa), Human(CHO-expressed) 
Catalog No.BK0258-1mg
SourceCHO
Molecular Weight ~9 kDa, observed by reducing SDS-PAGE
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50 < 6 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
1mg  $3360
$
Add to cart My orders
Recombinant :
Recombinant IL-8/CXCL8 (8-79aa), Human(CHO-expressed) 
Source :
CHO
Molecular Weight :
~9 kDa, observed by reducing SDS-PAGE
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50 < 6 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human Interleukin-8 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-8 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis. Other functions of this protein, such as involvement in bronchiolitis pathogenesis, have also been reported.
Blocking peptide available as BK0258-1mgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER