Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant MCP‑3/MARC/CCL7, Mouse   BK0265-50μg
RecombinantRecombinant MCP‑3/MARC/CCL7, Mouse  
Catalog No.BK0265-50μg
SourceCHO
Molecular Weight8~12 kDa, observed by reducing SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Biological ActivityThe EC50 value of mouse MCP 3 MARC/CCL7 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/mCCR2 cells (human Gα15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 1 μg/ml.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
50μg  $493.8
$
Add to cart My orders
Recombinant :
Recombinant MCP‑3/MARC/CCL7, Mouse  
Source :
CHO
Molecular Weight :
8~12 kDa, observed by reducing SDS-PAGE.
Purity :
> 98% as analyzed by SDS-PAGE.
Biological Activity :
The EC50 value of mouse MCP 3 MARC/CCL7 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/mCCR2 cells (human Gα15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 1 μg/ml.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEE AIAYLDMKTPTPKP
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Mouse MCP‑3/MARC/CCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse MCP‑3/MARC/CCL7 should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Chemokine (C-C motif) ligand 7 (CCL7) is a small cytokine that was previously called monocyte-specific chemokine 3 (MCP-3). Due to CCL7 possessing two adjacent N-terminal cysteine residues in its mature form, it is classified within the subfamily of chemokines known as CC chemokines. CCL7 specifically attracts monocytes, and regulates macrophage function. It is produced by certain tumor cell lines and by macrophages. This chemokine is located on chromosome 17 in humans, within a large cluster containing many other CC chemokines and is most closely related to CCL2. CCL7 can signal through the CCR1, CCR2 and CCR3 receptors.Recombinant Mouse MCP‑3/MARC/CCL7 produced in CHO cells is a polypeptide chain containing 74 amino acids. A fully biologically active molecule, rmMCP 3/CCL7 has a molecular mass of 8-12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0265-50μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER