Recombinant :
Recombinant M-CSF, Mouse Source :
CHO Molecular Weight :
35-44 kDa, observed by non-reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50< 3 ng/ml, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 3.3×10ˆ5 units/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERL QELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP Endotoxin :
<0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant murine Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells[2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4] .
Recombinant M-CSF, Mouse Source :
CHO Molecular Weight :
35-44 kDa, observed by non-reducing SDS-PAGE. Purity :
> 95% as analyzed by SDS-PAGE and HPLC. Biological Activity :
ED50< 3 ng/ml, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 3.3×10ˆ5 units/mg. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERL QELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP Endotoxin :
<0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant murine Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells[2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4] .
Blocking peptide available as BK0268-50μgP