Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant MIP-1β/CCL4, Human  BK0271-5μg
RecombinantRecombinant MIP-1β/CCL4, Human 
Catalog No.BK0271-5μg
SourceCHO
Molecular Weight10-19 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityThe EC50 value of human MIP-1 beta /CCL4 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells) is less than 150 ng/ml.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
5μg  $132
$
Add to cart My orders
Recombinant :
Recombinant MIP-1β/CCL4, Human 
Source :
CHO
Molecular Weight :
10-19 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
The EC50 value of human MIP-1 beta /CCL4 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells) is less than 150 ng/ml.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQ EYVYDLELN
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human MIP-1β/CCL4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-1β/CCL4 should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Macrophage inflammatory protein 1 beta (MIP-1β), also known as Chemokine (C-C motif) ligand 4 (CCL4), is a small cytokine belonging to the CC chemokine family. It is a chemo attractant for natural killer cells, monocytes and a variety of other immune cells. MIP-1β is a major HIV-suppressive factor produced by CD8+ T cells. Perforin-low memory CD8+ T cells are the most common T-cells that normally synthesize MIP-1-beta in humans. MIP-1β has been shown to interact with CCL3. It can signal through the CCR5 receptor.Recombinant MIP-1 beta/CCL4 produced in CHO is a polypeptide chain containing 69 amino acids. A fully biologically active molecule, rhMIP-1 beta/CCL4 has a molecular mass of 10-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0271-5μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER