Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant MIP-3α/CCL20, Human(CHO-expressed)  BK0272-5μg
RecombinantRecombinant MIP-3α/CCL20, Human(CHO-expressed) 
Catalog No.BK0272-5μg
SourceCHO
Molecular Weight8 kDa, observed by reducing SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Biological ActivityThe EC50 value of humanMIP-3 alpha/CCL20 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR6 cells (human Ga15 and human CCR6 stably expressed in CHO-K1 cells) is less than 200 ng/ml.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
5μg  $132
$
Add to cart My orders
Recombinant :
Recombinant MIP-3α/CCL20, Human(CHO-expressed) 
Source :
CHO
Molecular Weight :
8 kDa, observed by reducing SDS-PAGE.
Purity :
> 98% as analyzed by SDS-PAGE.
Biological Activity :
The EC50 value of humanMIP-3 alpha/CCL20 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCCR6 cells (human Ga15 and human CCR6 stably expressed in CHO-K1 cells) is less than 200 ng/ml.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIV RLLSKKVKNM
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human MIP-3 alpha/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human MIP-3 alpha/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Chemokine (C-C motif) ligand 20 (CCL20) also known as liver activation regulated chemokine (LARC) or Macrophage Inflammatory Protein-3 (MIP3 alpha) is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors.Recombinant humanMIP-3 alpha/CCL20 produced in CHO cells is a polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhMIP-3 alpha/CCL20 has a molecular mass of 8kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0272-5μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER