Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant NOV, Human  BK0279-50μg
RecombinantRecombinant NOV, Human 
Catalog No.BK0279-50μg
SourceCHO
Molecular Weight20-50 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
50μg  $700
$
Add to cart My orders
Recombinant :
Recombinant NOV, Human 
Source :
CHO
Molecular Weight :
20-50 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCV FDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRP EATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSL KAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELK TTRGKM
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human NOV remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human NOV should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Nephroblastoma Overexpressed Gene Protein (NOV), also known as CCN3, IGFBP9 and NOVH, is one of the CCN family of secreted proteins. It is expressed in bone marrow, thymic cells and nephroblastoma. NOV signals through integrin receptors, NOTCH1 and fibulin 1c to regulate multiple cellular activities, such as cell adhesion, migration, proliferation and differentiation. The reported functions of NOV are diverse. It has been reported to play a role in angiogenesis and stem cell self-renewal. It has also been implicated in osteogenic differentiation, embryo development and cancer pathogenesis.
Blocking peptide available as BK0279-50μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER