Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant SDF-1β/CXCL12, Mouse  BK0283-10μg
RecombinantRecombinant SDF-1β/CXCL12, Mouse 
Catalog No.BK0283-10μg
SourceCHO
Molecular Weight8.5 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityThe EC50 value of mouse SDF-1/CXCL12 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCXCR4 cells (human Gα15 and mCXCR4 stably expressed in CHO-K1 cells) is less than 2.5 μg/ml.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
10μg  $156
$
Add to cart My orders
Recombinant :
Recombinant SDF-1β/CXCL12, Mouse 
Source :
CHO
Molecular Weight :
8.5 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
The EC50 value of mouse SDF-1/CXCL12 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCXCR4 cells (human Gα15 and mCXCR4 stably expressed in CHO-K1 cells) is less than 2.5 μg/ml.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQE YLEKALNKRLKM
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Mouse SDF-1 β/CXCL12 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse SDF-1β/CXCL12 should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
SDF-1 α and SDF-1 β, members of the chemokine α subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 α and SDF-1 β cDNAs encode precursor proteins of 89 and 93 amino acid residues, respectively. Both SDF-1 α and SDF-1 β are encoded by a single gene and arise by alternative splicing. The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1 β and absent from SDF-1 α. SDF-1/PBSF is highly conserved between species, with only one amino acid substitution between the mature human and mouse proteins. SDF-1/PBSF acts via the chemokine receptor CXCR4 and has been shown to be a chemoattractant for T-lymphocytes, monocytes, pro- and pre-B cells, but not neutrophils. Mice lacking SDF-1 or CXCR4 have been found to have impaired B-lymphopoiesis, myelopoiesis, vascular development, cardiogenesis and abnormal neuronal cell migration and patterning in the central nervous system.Recombinant Mouse SDF-1 β/CXCL12 produced in CHO cells is a polypeptide chain containing 78 amino acids. A fully biologically active molecule, rm SDF-1β/CXCL12 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0283-10μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER