Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Thymus Chemokine‑1/CXCL7, Rat  BK0286-5μg
RecombinantRecombinant Thymus Chemokine‑1/CXCL7, Rat 
Catalog No.BK0286-5μg
SourceCHO
Molecular Weight9.8 kDa, observed by reducing SDS-PAGE.
Purity> 97% as analyzed by SDS-PAGE and HPLC.
Biological ActivityThe EC50 value of rat Thymus Chemokine‑1/CXCL7 on Caˆ2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 300 ng/ml.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin < 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
5μg  $132
$
Add to cart My orders
Recombinant :
Recombinant Thymus Chemokine‑1/CXCL7, Rat 
Source :
CHO
Molecular Weight :
9.8 kDa, observed by reducing SDS-PAGE.
Purity :
> 97% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
The EC50 value of rat Thymus Chemokine‑1/CXCL7 on Caˆ2+ mobilization assay in CHO-K1/Gα15/rCXCR2 cells (human Gα15 and rat CXCR2 stably expressed in CHO-K1 cells) is less than 300 ng/ml.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Rat Thymus Chemokine‑1/CXCL7 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Thymus Chemokine‑1/CXCL7 should be stable up to 1 week at 4°C or up to 3 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Thymus Chemokine‑1, also called Chemokine (C-X-C motif) ligand 7 (CXCL7) , is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, Thymus Chemokine‑1 has been shown to bind CXCR-2 and be a chemoattractant forneutrophils and play a role in their activation. Although CTAP-III, β-TG and PBP represent amino-terminal extended variants of Thymus Chemokine‑1 and possess the same CXC chemokine domains, these proteins do not exhibit Thymus Chemokine‑1 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III mask the critical ELR receptor binding domain that is exposed on Thymus Chemokine‑1 and may account for lack of Thymus Chemokine‑1 activity. Rat CXCL7 shares 72% amino acid sequence identity with mouse CXCL7.Recombinant rat Thymus Chemokine‑1/ CXCL7 produced in CHO cells is a polypeptide chain containing 62 amino acids. A fully biologically active molecule, rrThymus Chemokine‑1/CXCL7 has a molecular mass of 9.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0286-5μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER