Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant TPO, His, Rat  BK0288-50μg
RecombinantRecombinant TPO, His, Rat 
Catalog No.BK0288-50μg
SourceCHO
Molecular Weight22 kDa, observed by reducing SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Biological ActivityThe ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5 x 10ˆ6 units/mg.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
50μg  $493.8
$
Add to cart My orders
Recombinant :
Recombinant TPO, His, Rat 
Source :
CHO
Molecular Weight :
22 kDa, observed by reducing SDS-PAGE.
Purity :
> 98% as analyzed by SDS-PAGE.
Biological Activity :
The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5 x 10ˆ6 units/mg.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQ LEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTA VPSRTSQLLTLNKFHHHHHH
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Rat Thrombopoietin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Thrombopoietin should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Thrombopoietin (TPO), also known as c-Mpl ligand, MGDF and THOP, is a glycoprotein hormone belonging to the EPO/TPO family. It is expressed mainly in the liver, kidney and skeletal muscle. TPO binds and signals through c-Mpl receptor. It stimulates the proliferation and maturation of megakaryocytes from their committed progenitor cells, and it regulates the production and circulation of platelets. TPO has also been reported to promote apoptosis of hypoxia-sensitized neurons and to inhibit neuronal differentiation.Recombinant Rat Thrombopoietin(TPO), His, produced in CHO cells is a polypeptide chain containing 174 amino acids. A fully biologically active molecule, rrTPO has a molecular mass of 22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0288-50μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER