Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant VEGF-D, Human  BK0294-10μg
RecombinantRecombinant VEGF-D, Human 
Catalog No.BK0294-10μg
SourceCHO
Molecular Weight18-19 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50 < 1 μg /ml, measured in a cell proliferation assay using HUVEC cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
10μg  $228
$
Add to cart My orders
Recombinant :
Recombinant VEGF-D, Human 
Source :
CHO
Molecular Weight :
18-19 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50 < 1 μg /ml, measured in a cell proliferation assay using HUVEC cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEI SVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human VEGF-D remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human VEGF-D should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Vascular Endothelial Growth Factor (VEGF)-D, also known as c-Fos-induced growth factor (FIGF), is a member of the PDGF/VEGF growth factor family. It is expressed highly in lung, heart and small intestine, and at lower levels in skeletal muscle, colon and pancreas. It binds to VEGFR-2 and VEGFR-3 receptors and activates downstream signals. VEGF-D is a growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth. It is involved in many developmental and physiological processes including the formation of venous and lymphatic vascular systems during embryogenesis and the maintenance of differentiated lymphatic endothelium in adults. In tumor pathology, it has been reported to play a role in restructuring of lymphatic channels and regional lymph node metastasis.
Blocking peptide available as BK0294-10μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER