Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant WISP-1, Human  BK0295-5μg
RecombinantRecombinant WISP-1, Human 
Catalog No.BK0295-5μg
SourceCHO
Molecular Weight44-46 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityED50<0.5 μg/ml, measured in a bioassay using ATDC5 cells in the presence of 50 ng/ml human BMP-2.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
5μg  $132
$
Add to cart My orders
Recombinant :
Recombinant WISP-1, Human 
Source :
CHO
Molecular Weight :
44-46 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
ED50<0.5 μg/ml, measured in a bioassay using ATDC5 cells in the presence of 50 ng/ml human BMP-2.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
TALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCD YSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQ WVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVD IHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFC NLSCRNPNDIFADLESYPDFSEIAN
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant human WISP-1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human WISP-1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
WISP-1, also known as Wnt-1-inducible-signaling pathway protein 1, CCN4 and Wnt-1-induced secreted protein, is a cysteine-rich heparin-binding Glycoprotein belonging to the CCN protein family. It is expressed in many internal organs, such as the lung, kidney and spleen. WISP-1 binds to BMP-2 and enhances mesenchymal cell proliferation and osteoblastic differentiation. , WISP-1 has also been reported to attenuate p53-mediated apoptosis and inhibit TNF-induced cell death, suggesting it may play a role intumorigenesis.
Blocking peptide available as BK0295-5μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER