Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Adiponectin/Acrp30, Human  BK0296-50μg
RecombinantRecombinant Adiponectin/Acrp30, Human 
Catalog No.BK0296-50μg
SourceHEK 293
Molecular Weight16~17 kDa, observed by reducing SDS-PAGE.
Purity > 95% as analyzed by SDS-PAGE.
Biological ActivityED50 < 2 μg/ml, measured in a cell proliferation assay using M1 cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
50μg  $493.8
$
Add to cart My orders
Recombinant :
Recombinant Adiponectin/Acrp30, Human 
Source :
HEK 293
Molecular Weight :
16~17 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
ED50 < 2 μg/ml, measured in a cell proliferation assay using M1 cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human Adipolean/gArcp30 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adipolean/gArcp30 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Adipolean/gArcp30 is produced and secreted exclusively by adipocytes, and is a relatively abundant plasma protein, accounting for up to 0.05% of total serum protein. It is an adipocytederived protein with wide ranging paracrine and endocrine effects on metabolism and inflammation. It is induced during adipocyte differentiation, and its secretion is stimulated by insulin. It promotes adipocyte differentiation, fatty acid catabolism, and insulin sensitivity and is negatively correlated with obesity, type 2 diabetes, and atherogenesis.
Blocking peptide available as BK0296-50μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER