Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant Amphiregulin, Human  BK0297-50μg
RecombinantRecombinant Amphiregulin, Human 
Catalog No.BK0297-50μg
SourceHEK 293
Molecular Weight15~20 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
50μg  $420
$
Add to cart My orders
Recombinant :
Recombinant Amphiregulin, Human 
Source :
HEK 293
Molecular Weight :
15~20 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
ED50 < 0.2 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER CGEKSMKTHSMIDSSLSK
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human Amphiregulin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Amphiregulin should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Amphiregulin is a member of the EGF family of cytokines, which comprises at least ten proteins including EGF, TGF-α, HB-EGF, Epiregulin, Tomoregulin, Neuregulins and the various heregulins. Through the EGF/TGF-α receptor, it stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein.
Blocking peptide available as BK0297-50μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER