Recombinant ENA-78/CXCL5, Human(HEK 293-expressed) 
Datasheet
COA
MSDS
SHIP
Recombinant :
Recombinant ENA-78/CXCL5, Human(HEK 293-expressed) Source :
HEK 293 Molecular Weight :
8.5 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of human ENA-78/CXCL5 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA PFLKKVIQKILDGGNKEN Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant human ENA-78/CXCL5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human ENA-78/CXCL5 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of ENA-78 has also been observed in eosinophils, and can be inhibited with the type II interferon,IFN-γ. ENA-78 stimulates the chemotaxis of neutrophils possessing angiogenic properties. It plays a role in reducing sensitivity to sunburn pain in some subjects, and could be a potential target used to understand more about pain in other inflammatory conditions. ENA-78 is well known to have chemotactic and activating functions on neutrophils, mainly during acute inflammatory responses. It can signal through the CXCR2 receptor.Recombinant ENA-78/CXCL5 produced in 293 cells is a single polypeptide chain containing 78 amino acids. rhENA-78/CXCL5 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Recombinant ENA-78/CXCL5, Human(HEK 293-expressed) Source :
HEK 293 Molecular Weight :
8.5 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of human ENA-78/CXCL5 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 200 ng/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA PFLKKVIQKILDGGNKEN Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant human ENA-78/CXCL5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human ENA-78/CXCL5 should be stable up to 1 week at 4°C or up to 2 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Epithelial-derived neutrophil-activating peptide 78 (ENA-78) is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of ENA-78 has also been observed in eosinophils, and can be inhibited with the type II interferon,IFN-γ. ENA-78 stimulates the chemotaxis of neutrophils possessing angiogenic properties. It plays a role in reducing sensitivity to sunburn pain in some subjects, and could be a potential target used to understand more about pain in other inflammatory conditions. ENA-78 is well known to have chemotactic and activating functions on neutrophils, mainly during acute inflammatory responses. It can signal through the CXCR2 receptor.Recombinant ENA-78/CXCL5 produced in 293 cells is a single polypeptide chain containing 78 amino acids. rhENA-78/CXCL5 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0302-25μgP