Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant G-CSF, Rat (HEK 293-expressed)  BK0305-1mg
RecombinantRecombinant G-CSF, Rat (HEK 293-expressed) 
Catalog No.BK0305-1mg
SourceHEK 293
Molecular Weight25~28 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Biological ActivityED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
1mg  $4400
$
Add to cart My orders
Recombinant :
Recombinant G-CSF, Rat (HEK 293-expressed) 
Source :
HEK 293
Molecular Weight :
25~28 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity :
ED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.
Blocking peptide available as BK0305-1mgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER