Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant GRO-α/KC/CINC-1/CXCL1, Rat  BK0306-5μg
RecombinantRecombinant GRO-α/KC/CINC-1/CXCL1, Rat 
Catalog No.BK0306-5μg
SourceHEK 293
Molecular Weight~7.8 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityActive, measured in a functional assay using HUVEC cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
5μg  $132
$
Add to cart My orders
Recombinant :
Recombinant GRO-α/KC/CINC-1/CXCL1, Rat 
Source :
HEK 293
Molecular Weight :
~7.8 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
Active, measured in a functional assay using HUVEC cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Rat GRO/MGSA/CXCL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat GRO/MGSA/CXCL1 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.
Blocking peptide available as BK0306-5μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER