Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant IFN-β, Human  BK0307-25μg
RecombinantRecombinant IFN-β, Human 
Catalog No.BK0307-25μg
SourceHEK 293
Molecular Weight~23 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
25μg  $493.8
$
Add to cart My orders
Recombinant :
Recombinant IFN-β, Human 
Source :
HEK 293
Molecular Weight :
~23 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
ED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.
Blocking peptide available as BK0307-25μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER