Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant IL-22, Human(HEK 293-expressed)  BK0315-1mg
RecombinantRecombinant IL-22, Human(HEK 293-expressed) 
Catalog No.BK0315-1mg
SourceHEK 293
Molecular Weight16~28 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityActive, measured by its ability to activate STAT following receptor ligand interaction.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
1mg  $4400
$
Add to cart My orders
Recombinant :
Recombinant IL-22, Human(HEK 293-expressed) 
Source :
HEK 293
Molecular Weight :
16~28 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
Active, measured by its ability to activate STAT following receptor ligand interaction.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQP YMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human Interleukin-22 (IL-22) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-22 (IL-22) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Interleukin-22 (IL-22) is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family.
Blocking peptide available as BK0315-1mgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER