Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant IL-6, Rat (HEK 293-expressed)  BK0317-1mg
RecombinantRecombinant IL-6, Rat (HEK 293-expressed) 
Catalog No.BK0317-1mg
SourceHEK 293
Molecular Weight21~26 kDa , observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityED50 < 3 pg/ml, measured by a cell proliferation assay using 7TD1 Cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
1mg  $4400
$
Add to cart My orders
Recombinant :
Recombinant IL-6, Rat (HEK 293-expressed) 
Source :
HEK 293
Molecular Weight :
21~26 kDa , observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
ED50 < 3 pg/ml, measured by a cell proliferation assay using 7TD1 Cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGY NQEICLLKICSGLLEFRFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLESQKEW LRTKTIQLILKALEEFLKVTMRSTRQT
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Rat Interleukin-6(IL-6) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, it should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Interleukin-6 (IL-6) is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, Interleukin-6 (IL-6) has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. Interleukin-6 (IL-6) signals through the IL-6 receptor system that consists of two chains, IL-6R alpha and gp130.
Blocking peptide available as BK0317-1mgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER