Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant I‑TAC/CXCL11, Human(HEK 293-expressed)  BK0319-50μg
RecombinantRecombinant I‑TAC/CXCL11, Human(HEK 293-expressed) 
Catalog No.BK0319-50μg
SourceHEK 293
Molecular Weight8.3 kDa, observed by reducing SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Biological ActivityThe EC50 value of human I‑TAC/CXCL11 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR3 cells (human Ga15 and human CXCR3 stably expressed in CHO-K1 cells) is less than 0.5 μg/ml.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
50μg  $420
$
Add to cart My orders
Recombinant :
Recombinant I‑TAC/CXCL11, Human(HEK 293-expressed) 
Source :
HEK 293
Molecular Weight :
8.3 kDa, observed by reducing SDS-PAGE.
Purity :
> 98% as analyzed by SDS-PAGE.
Biological Activity :
The EC50 value of human I‑TAC/CXCL11 on Caˆ2+ mobilization assay in CHO-K1/Ga15/hCXCR3 cells (human Ga15 and human CXCR3 stably expressed in CHO-K1 cells) is less than 0.5 μg/ml.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQ ARLIIKKVERKNF
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100μg/ml.
Storage :
Lyophilized recombinant humanI‑TAC/ CXCL11 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, humanCXCL11/I‑TAC should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Chemokine (C-X-C motif) ligand 11(CXCL11), also known as I-TAC and B-R1, is a small cytokine belonging to the CXC chemokine family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-9).This chemokine elicits its effects on target cells by interacting with chemokine receptor CXCR3 having a higher affinity than other ligands for this receptor such as CXCL9 and CXCL10. CXCL11 is chemotactic for activated T cells. The gene encoding CXCL11 has been mapped to chromosome 4. CXCL11 cDNA encodes a 94 amino acid residue precursor protein with a 21 amino acid residue putative signal sequence, which is cleaved to form the mature 73 amino acid residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. Mouse CXCL11 exhibits 68% sequence homology with human CXCL11.Recombinant human I-TAC/CXCL11 produced in HEK293 cells is a single non-glycosylated polypeptide chain containing 73amino acids. A fully biologically active molecule, rhI-TAC/CXCL11 has a molecular mass of 8.3 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0319-50μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER