Recombinant :
Recombinant MCP-1/CCL2, Rat Source :
HEK 293 Molecular Weight :
10~15 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of rat MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/G15/rCCR2 cells (human G15 and rat CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWV QKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVT SMTEN Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Rat MCP-1/CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat MCP-1/CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant rat MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 125 amino acids. A fully biologically active molecule, rrMCP-1/CCL2 has a molecular mass of 10-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Recombinant MCP-1/CCL2, Rat Source :
HEK 293 Molecular Weight :
10~15 kDa, observed by reducing SDS-PAGE. Purity :
> 98% as analyzed by SDS-PAGE. Biological Activity :
The EC50 value of rat MCP-1/CCL2 on Caˆ2+ mobilization assay in CHO-K1/G15/rCCR2 cells (human G15 and rat CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/ml. Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder. Formulation :
Lyophilized after extensive dialysis against PBS. AA Sequence :
QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWV QKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVT SMTEN Endotoxin :
< 0.2 EU/μg, determined by LAL method. Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml. Storage :
Lyophilized recombinant Rat MCP-1/CCL2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat MCP-1/CCL2 should be stable up to 1 week at 4°C or up to 3 months at -20°C. Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only. Description :
Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor.Recombinant rat MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 125 amino acids. A fully biologically active molecule, rrMCP-1/CCL2 has a molecular mass of 10-15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0321-25μgP