Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant PDGF-CC, Human  BK0327-50μg
RecombinantRecombinant PDGF-CC, Human 
Catalog No.BK0327-50μg
SourceHEK 293
Molecular Weight15~19 kDa, observed by reducing SDS-PAGE.
Purity> 95% as analyzed by SDS-PAGE.
Biological ActivityED50 < 1 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
50μg  $420
$
Add to cart My orders
Recombinant :
Recombinant PDGF-CC, Human 
Source :
HEK 293
Molecular Weight :
15~19 kDa, observed by reducing SDS-PAGE.
Purity :
> 95% as analyzed by SDS-PAGE.
Biological Activity :
ED50 < 1 ng/ml, measured in a cell proliferation assay using 3T3 cells.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK TGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant Human Platelet-derived growth factor (PDGF) -CC remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Platelet-derived growth factor (PDGF) -CC should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB).
Blocking peptide available as BK0327-50μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER