Contact us : info@bioworlde.com
Home > Product > Cytokine & Recombinant Proteins
Recombinant RANTES/CCL5, Human(HEK 293-expressed)  BK0329-25μg
RecombinantRecombinant RANTES/CCL5, Human(HEK 293-expressed) 
Catalog No.BK0329-25μg
SourceHEK 293
Molecular Weight8 kDa, observed by reducing SDS-PAGE.
Purity> 98% as analyzed by SDS-PAGE.
Biological ActivityThe EC50 value of human RANTES/CCL5 on Caˆ2+ mobilization assay in CHO-K1/Gα15/hCCR1 cells (human Gα15 and human CCR1 stably expressed in CHO-K1 cells) is less than 0.2 μg/ml.
Physical AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationLyophilized after extensive dialysis against PBS.
Endotoxin< 0.2 EU/μg, determined by LAL method.
Browse similar products>>
Size Price
25μg  $228
$
Add to cart My orders
Recombinant :
Recombinant RANTES/CCL5, Human(HEK 293-expressed) 
Source :
HEK 293
Molecular Weight :
8 kDa, observed by reducing SDS-PAGE.
Purity :
> 98% as analyzed by SDS-PAGE.
Biological Activity :
The EC50 value of human RANTES/CCL5 on Caˆ2+ mobilization assay in CHO-K1/Gα15/hCCR1 cells (human Gα15 and human CCR1 stably expressed in CHO-K1 cells) is less than 0.2 μg/ml.
Physical Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation :
Lyophilized after extensive dialysis against PBS.
AA Sequence :
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVRE YINSLEMS
Endotoxin :
< 0.2 EU/μg, determined by LAL method.
Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage :
Lyophilized recombinant human RANTES/CCL5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human RANTES/CCL5 should be stable up to 1 week at 4°C or up to 2 months at -20°C
Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description :
Chemokine (C-C motif) ligand 5(CCL5), also known as RANTES (Regulated upon activation, Normal T cell Expressed and presumable Secreted) is a CC-chemokine that can signal through the CCR1, CCR3, CCR5 and US28 (cytomegalovirus receptor) receptors. RANTES is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes in inflammatory sites. With the help of specific cytokines (i.e., IL-2 and IFN-γ) that are released by T cells, RANTES induces the proliferation and activation of certain natural-killer (NK) cells to form CHAK (CC-Chemokine-activated killer) cells. RANTES is also an HIV-suppressive factor released from CD8+ T cells. This chemokine has been localized to chromosome 17 in humans. It has the capability to inhibit certain strains of HIV-1, HIV-2 and simian immunodeficiency virus (SIV).Recombinant human RANTES/CCL5 produced in HEK293 cells is a single polypeptide chain containing 68 amino acids. A fully biologically active molecule, rhRANTES/CCL5 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Blocking peptide available as BK0329-25μgP
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER