Contact us : info@bioworlde.com
Home > Product > T/B-cell surface proteins
CD15 Recombinant Protein NCP0178
Product NameCD15 Recombinant Protein
Catalog No.NCP0178
Swiss-ProtP22083
Host E.coli
TagHis-tag in C-terminal
Restriction sitesNdeI-XhoI
Background
SolublePBS, 4M Urea, PH7.4
Purification&PurityTransferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Concentration≥0.5mg/ml
Browse similar products>>
Size Price
500ug $638
1mg $1128
Add to cart My orders
Product Name :
CD15 Recombinant Protein
Swiss-Prot :
P22083
Host :
E.coli
Tag :
≥0.5mg/ml
Amino acid Sequence :
GQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER
Restriction sites :
NdeI-XhoI
Background :
SSEA-1 antibody detects a lactoseries oligosaccharide antigen that is expressed on the surface of mouse embryonal carcinoma and embryonic stem cells. This antigen is also found on early mouse embryos and both mouse and human germ cells, but is absent on human embryonic stem cells and human embryonic carcinoma cells. Expression of SSEA1 in these human cell types increases upon differentiation, while on the mouse cell types differentiation leads to decreased expression.
Soluble :
PBS, 4M Urea, PH7.4
Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression vector :
pet-22b(+)
BiowMW :
~39kDa
Note :
For research use only, not for use in diagnostic procedure.
concentration :
≥0.5mg/ml
Blocking peptide available as NCP0178P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER